IGF DES (2mg) – ≥99% Purity | Research-Grade Standard
The 67-amino acid sequence for IGF-DES (Des[1-3]IGF-1) is:
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Please note:
This product is for Research purposes Only
Used solely for in vitro experiments
Cannot be used for:
Clinical trials involving humans.
Administering to humans as part of an experiment or investigation.
Supply to another party for human investigational use.





Reviews
There are no reviews yet.